Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 16283MI

MilliporeSigma™ anti-MAP Kinase 1/2 (Erk1/2), Alexa Fluor 488, Polyclonal,

Catalog No. 16283MI Shop All MilliporeSigma Products
Change view
Click to view available options
Quantity:
50 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
16-283-MI 50 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 16-283-MI Supplier MilliporeSigma™ Supplier No. 16283

Specifications

Antigen MAP Kinase 1/2 (Erk1/2)
Applications Flow Cytometry, Immunocytochemistry, Immunofluorescence, Western Blot
Classification Polyclonal
Conjugate Alexa Fluor 488
Gene Symbols MAPK1; p40; PRKM2; MAPK2; PRKM1; p42-MAPK; p38; p41; ERK; ERK-2; ERT1; P42MAPK; p41mapk; ERK2
Host Species Rabbit
Immunogen 38 residue synthetic peptide (CGG-PFTFDMELDDLPKERLKELIFQETARFQPGAPEAP) corresponding to the C-terminal 35 amino acids of the rat 44kDa MAP Kinase 2/Erk2 coupled to KLH. The immunizing sequence is totally conserved in Chinese hamster, is 34/35 identical i
Purification Method Affinity Purified
Quantity 50 μg
Primary or Secondary Primary
Gene ID (Entrez) NM_002745.4; NM_138957.2
Target Species Chicken, Human, Mouse, Rat
Content And Storage 4°C for 12 months
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.