Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

microtubule-associated protein 1 light chain 3 alpha, Mouse, Clone: 1D5, Abnova™

Catalog No. 89001372 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-001-372 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-001-372 Supplier Abnova Corporation Supplier No. H00084557M07
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant MAP1LC3A.

MAP1A and MAP1B are microtubule-associated proteins which mediate the physical interactions between microtubules and components of the cytoskeleton. MAP1A and MAP1B each consist of a heavy chain subunit and multiple light chain subunits. The protein encoded by this gene is one of the light chain subunits and can associate with either MAP1A or MAP1B. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQE

Specifications

Antigen microtubule-associated protein 1 light chain 3 alpha
Applications ELISA
Classification Monoclonal
Clone 1D5
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant MAP1LC3A.
Formulation PBS with no preservative; pH 7.4
Gene MAP1LC3A
Gene Accession No. NM_032514
Gene Alias LC3/LC3A/MAP1ALC3/MAP1BLC3
Gene Symbols MAP1LC3A
Host Species Mouse
Immunogen MAP1LC3A (NP_115903, 1 a.a. ∼ 102 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 84557
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.