microtubule-associated protein 1 light chain 3 alpha, Mouse, Clone: 1D5, Abnova™

Catalog No.	Quantity
89-001-372	100 μg

Catalog No. 89-001-372 Supplier Abnova Corporation Supplier No. H00084557M07

Description

Mouse monoclonal antibody raised against a partial recombinant MAP1LC3A.

MAP1A and MAP1B are microtubule-associated proteins which mediate the physical interactions between microtubules and components of the cytoskeleton. MAP1A and MAP1B each consist of a heavy chain subunit and multiple light chain subunits. The protein encoded by this gene is one of the light chain subunits and can associate with either MAP1A or MAP1B. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQE

Specifications

• Antigen: microtubule-associated protein 1 light chain 3 alpha
• Applications: ELISA
• Classification: Monoclonal
• Clone: 1D5
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant MAP1LC3A.
• Formulation: PBS with no preservative; pH 7.4
• Gene: MAP1LC3A
• Gene Accession No.: NM_032514
• Gene Alias: LC3/LC3A/MAP1ALC3/MAP1BLC3
• Gene Symbols: MAP1LC3A
• Host Species: Mouse
• Immunogen: MAP1LC3A (NP_115903, 1 a.a. ∼ 102 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 84557
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ