MAP2K6, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-003-060	50 μL

Catalog No. 89-003-060 Supplier Abnova Corporation Supplier No. H00005608A01

Description

Mouse polyclonal antibody raised against a partial recombinant MAP2K6.

This gene encodes a member of the dual specificity protein kinase family, which functions as a mitogen-activated protein (MAP) kinase kinase. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act as an integration point for multiple biochemical signals. This protein phosphorylates and activates p38 MAP kinase in response to inflammatory cytokines or environmental stress. As an essential component of p38 MAP kinase mediated signal transduction pathway, this gene is involved in many cellular processes such as stress induced cell cycle arrest, transcription activation and apoptosis. [provided by RefSeq

Sequence: QKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILGD

Specifications

• Antigen: MAP2K6
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant MAP2K6.
• Formulation: 50% glycerol
• Gene: MAP2K6
• Gene Accession No.: BC012009
• Gene Alias: MAPKK6/MEK6/MKK6/PRKMK6/SAPKK3
• Gene Symbols: MAP2K6
• Host Species: Mouse
• Immunogen: MAP2K6 (AAH12009, 231 a.a. ∼ 334 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 5608
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid