MAP2K6, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant MAP2K6.

Supplier:  Abnova Corporation H00005608A01

Catalog No. 89-003-060

Description

This gene encodes a member of the dual specificity protein kinase family, which functions as a mitogen-activated protein (MAP) kinase kinase. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act as an integration point for multiple biochemical signals. This protein phosphorylates and activates p38 MAP kinase in response to inflammatory cytokines or environmental stress. As an essential component of p38 MAP kinase mediated signal transduction pathway, this gene is involved in many cellular processes such as stress induced cell cycle arrest, transcription activation and apoptosis. [provided by RefSeq

Sequence: QKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILGD

Specifications

• Antigen: MAP2K6
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant MAP2K6.
• Gene: MAP2K6
• Gene Alias: MAPKK6/MEK6/MKK6/PRKMK6/SAPKK3
• Host Species: Mouse
• Quantity: 50 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: BC012009
• Gene Symbols: MAP2K6
• Immunogen: MAP2K6 (AAH12009, 231 a.a. ∼ 334 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Gene ID (Entrez): 5608
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.