mitogen-activated protein kinase kinase kinase 2, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-511	50 μL

Catalog No. 89-004-511 Supplier Abnova Corporation Supplier No. H00010746A01

Description

Mouse polyclonal antibody raised against a partial recombinant MAP3K2.

The protein encoded by this gene is a member of serine/threonine protein kinase family. This kinase preferentially activates other kinases involved in the MAP kinase signaling pathway. This kinase has been shown to directly phosphorylate and activate Ikappa B kinases, and thus plays a role in NF-kappa B signaling pathway. This kinase has also been found to bind and activate protein kinase C-related kinase 2, which suggests its involvement in a regulated signaling process. [provided by RefSeq

Sequence: HMKSLKILLVINGSTQATNLEPLPSLEDLDNTVFGAERKKRLSIIGPTSRDRSSPPPGYIPDELHQVARNGSFTSINSEGEFIPESMEQM

Specifications

• Antigen: mitogen-activated protein kinase kinase kinase 2
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant MAP3K2.
• Formulation: 50% glycerol
• Gene: MAP3K2
• Gene Accession No.: NM_006609
• Gene Alias: MEKK2/MEKK2B
• Gene Symbols: MAP3K2
• Host Species: Mouse
• Immunogen: MAP3K2 (NP_006600, 111 a.a. ∼ 200 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Research Discipline: Kinases
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 10746
• Target Species: Human, Mouse
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum