mitogen-activated protein kinase kinase kinase 4, Mouse, Clone: 4F10, Abnova™

Catalog No.	Quantity
89-000-803	100 μg

Catalog No. 89-000-803 Supplier Abnova Corporation Supplier No. H00004216M08

Description

Mouse monoclonal antibody raised against a partial recombinant MAP3K4.

The central core of each mitogen-activated protein kinase (MAPK) pathway is a conserved cascade of 3 protein kinases: an activated MAPK kinase kinase (MAPKKK) phosphorylates and activates a specific MAPK kinase (MAPKK), which then activates a specific MAPK. While the ERK MAPKs are activated by mitogenic stimulation, the CSBP2 and JNK MAPKs are activated by environmental stresses such as osmotic shock, UV irradiation, wound stress, and inflammatory factors. This gene encodes a MAPKKK, the MEKK4 protein, also called MTK1. This protein contains a protein kinase catalytic domain at the C terminus. The N-terminal nonkinase domain may contain a regulatory domain. Expression of MEKK4 in mammalian cells activated the CSBP2 and JNK MAPK pathways, but not the ERK pathway. In vitro kinase studies indicated that recombinant MEKK4 can specifically phosphorylate and activate PRKMK6 and SERK1, MAPKKs that activate CSBP2 and JNK, respectively but cannot phosphorylate PRKMK1, an MAPKK that activates ERKs. MEKK4 is a major mediator of environmental stresses that activate the CSBP2 MAPK pathway, and a minor mediator of the JNK pathway. Two alternatively spliced transcripts encoding distinct isoforms have been described. [provided by RefSeq

Sequence: AASRPSPSGGDSVLPKSISSAHDTRGSSVPENDRLASIAAELQFRSLSRHSSPTEERDEPAYPRGDSSGSTRRSWELRTLISQSKDTASKLGPIEAIQKS

Specifications

• Antigen: mitogen-activated protein kinase kinase kinase 4
• Applications: ELISA, Immunohistochemistry (PFA fixed), Western Blot
• Classification: Monoclonal
• Clone: 4F10
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant MAP3K4.
• Formulation: PBS with no preservative; pH 7.4
• Gene: MAP3K4
• Gene Accession No.: NM_005922
• Gene Alias: FLJ42439/KIAA0213/MAPKKK4/MEKK4/MTK1/PRO0412
• Gene Symbols: MAP3K4
• Host Species: Mouse
• Immunogen: MAP3K4 (NP_005913, 1201 a.a. ∼ 1300 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Kinases
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 4216
• Target Species: Human, Mouse
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG1 κ