MAP3K6, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant MAP3K6.

Supplier:  Abnova Corporation H00009064A01

Catalog No. 89-003-109

Description

This gene encodes a member of the serine/threonine protein kinase family. The encoded kinase was identified by its interaction with MAP3K5/ASK, a protein kinase and an activator of c-Jun kinase (MAPK7/JNK) and MAPK14/p38 kinase. This kinase was found to weakly activate MAPK7, but not MAPK1/ERK or MAPK14. An alternatively spliced transcript variant has been found for this gene, but its biological validity has not been determined. [provided by RefSeq

Sequence: HFWLHFLLQSCQPFKTACAQGDQCLVLVLEMNKVLLPAKLEVRGTDPVSTVTLSLLEPETQDIPSSWTFPVASICGVSASKRDERCCFLYALPPAQDVQLC

Specifications

• Antigen: MAP3K6
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant MAP3K6.
• Gene: MAP3K6
• Gene Alias: ASK2/MAPKKK6/MGC125653/MGC20114
• Host Species: Mouse
• Quantity: 50 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: BC015914
• Gene Symbols: MAP3K6
• Immunogen: MAP3K6 (AAH15914, 225 a.a. ∼ 325 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Gene ID (Entrez): 9064
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.