mitogen-activated protein kinase kinase kinase kinase 4, Mouse, Clone: 4A5, Abnova™

Catalog No.	Quantity
89-001-136	100 μg

Catalog No. 89-001-136 Supplier Abnova Corporation Supplier No. H00009448M07

Description

Mouse monoclonal antibody raised against a partial recombinant MAP4K4.

The protein encoded by this gene is a member of the serine/threonine protein kinase family. This kinase has been shown to specifically activate MAPK8/JNK. The activation of MAPK8 by this kinase is found to be inhibited by the dominant-negative mutants of MAP3K7/TAK1, MAP2K4/MKK4, and MAP2K7/MKK7, which suggests that this kinase may function through the MAP3K7-MAP2K4-MAP2K7 kinase cascade, and mediate the TNF-alpha signaling pathway. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq

Sequence: VHPALQRPAEPQVQWSHLASLKNNVSPVSRSHSFSDPSPKFAHHHLRSQDPCPPSRSEVLSQSSDSKSEAPDPTQKAWSRSDSDEVPPRVPVRTTSRSPV

Specifications

• Antigen: mitogen-activated protein kinase kinase kinase kinase 4
• Applications: ELISA, Immunohistochemistry (PFA fixed), Western Blot
• Classification: Monoclonal
• Clone: 4A5
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant MAP4K4.
• Formulation: PBS with no preservative; pH 7.4
• Gene: MAP4K4
• Gene Accession No.: NM_145686
• Gene Alias: FLH21957/FLJ10410/FLJ20373/FLJ90111/HGK/KIAA0687/NIK
• Gene Symbols: MAP4K4
• Host Species: Mouse
• Immunogen: MAP4K4 (NP_663719, 611 a.a. ∼ 710 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Kinases
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 9448
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG1 κ