mitogen-activated protein kinase 11, Rabbit, Purified MaxPab™ Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against a full-length human MAPK11 protein.

Supplier:  Abnova Corporation H00005600D01P

Catalog No. 89-018-385

Description

The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation, and development. This kinase is most closely related to p38 MAP kinase, both of which can be activated by proinflammatory cytokines and environmental stress. This kinase is activated through its phosphorylation by MAP kinase kinases (MKKs), preferably by MKK6. Transcription factor ATF2/CREB2 has been shown to be a substrate of this kinase. [provided by RefSeq

Sequence: MSGPRAGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQSLIHARRTYRELRLLKHLKHENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNNIVKCQALSDEHVQFLVYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADEEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGSDYIDQLKRIMEVVGTPSPEVLAKISSEHARTYIQSLPPMPQKDLSSIFRGANPLAIDLLGRMLVLDSDQRVSAAEALAHAYFSQYHDPEDEPEAEPYDESVEAKERTLEEWKELTYQEVLSFKPPEPPKPPGSLEIEQ

Specifications

• Antigen: mitogen-activated protein kinase 11
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against a full-length human MAPK11 protein.
• Gene: MAPK11
• Gene Alias: P38B/P38BETA2/PRKM11/SAPK2/SAPK2B/p38-2/p38Beta
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: In situ PLA, Western Blot
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_002751.5
• Gene Symbols: MAPK11
• Immunogen: MAPK11 (NP_002742.3, 1 a.a. ∼ 364 a.a) full-length human protein.
• Quantity: 100 μg
• Research Discipline: Kinases
• Gene ID (Entrez): 5600
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG