mitogen-activated protein kinase 11, Rabbit, Purified MaxPab™ Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-018-385	100 μg

Catalog No. 89-018-385 Supplier Abnova Corporation Supplier No. H00005600D01P

Description

Rabbit polyclonal antibody raised against a full-length human MAPK11 protein.

The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation, and development. This kinase is most closely related to p38 MAP kinase, both of which can be activated by proinflammatory cytokines and environmental stress. This kinase is activated through its phosphorylation by MAP kinase kinases (MKKs), preferably by MKK6. Transcription factor ATF2/CREB2 has been shown to be a substrate of this kinase. [provided by RefSeq

Sequence: MSGPRAGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQSLIHARRTYRELRLLKHLKHENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNNIVKCQALSDEHVQFLVYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADEEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGSDYIDQLKRIMEVVGTPSPEVLAKISSEHARTYIQSLPPMPQKDLSSIFRGANPLAIDLLGRMLVLDSDQRVSAAEALAHAYFSQYHDPEDEPEAEPYDESVEAKERTLEEWKELTYQEVLSFKPPEPPKPPGSLEIEQ

Specifications

• Antigen: mitogen-activated protein kinase 11
• Applications: In situ PLA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against a full-length human MAPK11 protein.
• Formulation: PBS with no preservative; pH 7.4
• Gene: MAPK11
• Gene Accession No.: NM_002751.5
• Gene Alias: P38B/P38BETA2/PRKM11/SAPK2/SAPK2B/p38-2/p38Beta
• Gene Symbols: MAPK11
• Host Species: Rabbit
• Immunogen: MAPK11 (NP_002742.3, 1 a.a. ∼ 364 a.a) full-length human protein.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Kinases
• Primary or Secondary: Primary
• Gene ID (Entrez): 5600
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG