MAPK14, Mouse, Clone: 3D5, Abnova™

Mouse monoclonal antibody raised against a partial recombinant MAPK14.

Manufacturer: Abnova Corporation H00001432M01A

Catalog No. 89-021-182

  Check Availability
Add to Cart

    Specifications

    Antigen MAPK14
    Applications Enzyme Linked Immunosorbent Assay,Western Blotting
    Clone 3D5
    Conjugate Unlabeled
    Cross Reactivity Human
    Description mitogen-activated protein kinase 14
    Format Ascites
    Formulation In ascites fluid
    Gene MAPK14
    Gene Accession No. BC031574
    Gene Alias CSBP1, CSBP2, CSPB1, EXIP, Mxi2, PRKM14, PRKM15, RK, SAPK2A, p38, p38ALPHA
    Gene Symbols MAPK14
    Host Species Mouse
    Immunogen MAPK14 (AAH31574, 260 a.a. ∽360 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26kDa.
    Isotype IgG1, κ
    Quantity 200μL
    Regulatory Status RUO
    Species Reactivity Human
    Storage Requirements Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
    Primary or Secondary Primary
    Monoclonal or Polyclonal Monoclonal
    Gene ID (Entrez) 1432

    The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase is activated by various environmental stresses and proinflammatory cytokines. The activation requires its phosphorylation by MAP kinase kinases (MKKs), or its autophosphorylation triggered by the interaction of MAP3K7IP1/TAB1 protein with this kinase. The substrates of this kinase include transcription regulator ATF2, MEF2C, and MAX, cell cycle regulator CDC25B, and tumor suppressor p53, which suggest the roles of this kinase in stress related transcription and cell cycle regulation, as well as in genotoxic stress response. Four alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. [provided by RefSeq

    Sequence: QSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES

  • Description & Specifications

Related Products


Product Content Feedback

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit