MAPK3, Mouse, Clone: 1E2, Abnova™

Catalog No.	Quantity
89-123-275	100 μg

Catalog No. 89-123-275 Supplier Abnova Corporation Supplier No. H00005595M03

Description

Mouse monoclonal antibody raised against a partial recombinant MAPK3.

The protein encoded by this gene is a member of the MAP kinase family. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act in a signaling cascade that regulates various cellular processes such as proliferation, differentiation, and cell cycle progression in response to a variety of extracellular signals. This kinase is activated by upstream kinases, resulting in its translocation to the nucleus where it phosphorylates nuclear targets. Alternatively spliced transcript variants encoding different protein isoforms have been described. [provided by RefSeq

Sequence: NYLQSLPSKTKVAWAKLFPKSDSKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFAMELDDLPKERLKELIFQETARFQPGVLEAP

Specifications

• Antigen: MAPK3
• Applications: ELISA, Immunofluorescence, Western Blot
• Classification: Monoclonal
• Clone: 1E2
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant MAPK3.
• Formulation: PBS with no preservative; pH 7.4
• Gene: MAPK3
• Gene Accession No.: BC013992
• Gene Alias: ERK1/HS44KDAP/HUMKER1A/MGC20180/P44ERK1/P44MAPK/PRKM3
• Gene Symbols: MAPK3
• Host Species: Mouse
• Immunogen: MAPK3 (AAH13992, 279 a.a. ∼ 379 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 5595
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2a κ