mitogen-activated protein kinase 6, Mouse, Clone: 4C11, Abnova™

Catalog No.	Quantity
89-000-900	50 μg

Catalog No. 89-000-900 Supplier Abnova Corporation Supplier No. H00005597M02

Description

Mouse monoclonal antibody raised against a partial recombinant MAPK6.

The protein encoded by this gene is a member of the Ser/Thr protein kinase family, and is most closely related to mitogen-activated protein kinases (MAP kinases). MAP kinases also known as extracellular signal-regulated kinases (ERKs), are activated through protein phosphorylation cascades and act as integration points for multiple biochemical signals. This kinase is localized in the nucleus, and has been reported to be activated in fibroblasts upon treatment with serum or phorbol esters. [provided by RefSeq

Sequence: EVRKDEQVEKENTYTSYLDKFFSRKEDTEMLETEPVEDGKLGERGHEEGFLNNSGEFLFNKQLESIGIPQFHSPVGSPLKSIQATLTPSAMKSSPQIPHQTYSSILKHLN

Specifications

• Antigen: mitogen-activated protein kinase 6
• Applications: ELISA, Immunofluorescence, Western Blot
• Classification: Monoclonal
• Clone: 4C11
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant MAPK6.
• Formulation: PBS with no preservative; pH 7.4
• Gene: MAPK6
• Gene Accession No.: BC035492
• Gene Alias: DKFZp686F03189/ERK3/HsT17250/PRKM6/p97MAPK
• Gene Symbols: MAPK6
• Host Species: Mouse
• Immunogen: MAPK6 (AAH35492, 612 a.a. ∼ 721 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 50 μg
• Regulatory Status: RUO
• Research Discipline: Cell Cycle
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 5597
• Target Species: Human, Mouse, Rat
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2b κ