mitogen-activated protein kinase 9, Mouse, Clone: 2F8, Abnova™

Catalog No.	Quantity
89-000-902	100 μg

Catalog No. 89-000-902 Supplier Abnova Corporation Supplier No. H00005601M02

Description

Mouse monoclonal antibody raised against a partial recombinant MAPK9.

The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase targets specific transcription factors, and thus mediates immediate-early gene expression in response to various cell stimuli. It is most closely related to MAPK8, both of which are involved in UV radiation induced apoptosis, thought to be related to the cytochrome c-mediated cell death pathway. This gene and MAPK8 are also known as c-Jun N-terminal kinases. This kinase blocks the ubiquitination of tumor suppressor p53, and thus it increases the stability of p53 in nonstressed cells. Studies of this gene's mouse counterpart suggest a key role in T-cell differentiation. Several alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq]

Sequence: ITVWYDPAEAEAPPPQIYDAQLEEREHAIEEWKELIYKEVMDWEERSKNGVVKDQPSDAAVSSNATPSQSSSINDISSMSTEQTLASDTDSSLDASTGPLEGCR

Specifications

• Antigen: mitogen-activated protein kinase 9
• Applications: ELISA, Immunofluorescence, In situ PLA, Western Blot
• Classification: Monoclonal
• Clone: 2F8
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant MAPK9.
• Formulation: PBS with no preservative; pH 7.4
• Gene: MAPK9
• Gene Accession No.: BC032539
• Gene Alias: JNK-55/JNK2/JNK2A/JNK2ALPHA/JNK2B/JNK2BETA/PRKM9/SAPK/p54a/p54aSAPK
• Gene Symbols: MAPK9
• Host Species: Mouse
• Immunogen: MAPK9 (AAH32539, 321 a.a. ∼ 424 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Kinases
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 5601
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG1 λ