mitogen-activated protein kinase-activated protein kinase 3, Mouse, Clone: 2B5, Abnova™

Catalog No.	Quantity
89-001-070	100 μg

Catalog No. 89-001-070 Supplier Abnova Corporation Supplier No. H00007867M02

Description

Mouse monoclonal antibody raised against a partial recombinant MAPKAPK3.

This gene encodes a member of the Ser/Thr protein kinase family. This kinase functions as a mitogen-activated protein kinase (MAP kinase)- activated protein kinase. MAP kinases are also known as extracellular signal-regulated kinases (ERKs), act as an integration point for multiple biochemical signals. This kinase was shown to be activated by growth inducers and stress stimulation of cells. In vitro studies demonstrated that ERK, p38 MAP kinase and Jun N-terminal kinase were all able to phosphorylate and activate this kinase, which suggested the role of this kinase as an integrative element of signaling in both mitogen and stress responses. This kinase was reported to interact with, phosphorylate and repress the activity of E47, which is a basic helix-loop-helix transcription factor known to be involved in the regulation of tissue-specific gene expression and cell differentiation. [provided by RefSeq

Sequence: EVSEDAKQLIRLLLKTDPTERLTITQFMNHPWINQSMVVPQTPLHTARVLQEDKDHWDEVKEEMTSALATMRVDYDQVKIKDLKTSNNRLLNKRRKKQAGSSSASQGCNNQ

Specifications

• Antigen: mitogen-activated protein kinase-activated protein kinase 3
• Applications: ELISA, Immunohistochemistry (PFA fixed), In situ PLA, Western Blot
• Classification: Monoclonal
• Clone: 2B5
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant MAPKAPK3.
• Formulation: PBS with no preservative; pH 7.4
• Gene: MAPKAPK3
• Gene Accession No.: BC001662
• Gene Alias: 3PK/MAPKAP3
• Gene Symbols: MAPKAPK3
• Host Species: Mouse
• Immunogen: MAPKAPK3 (AAH01662, 272 a.a. ∼ 382 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Kinases
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 7867
• Target Species: Human, Mouse
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ