microtubule-associated protein, RP/EB family, member 1, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-007-216	50 μL

Catalog No. 89-007-216 Supplier Abnova Corporation Supplier No. H00022919B01

Description

Mouse polyclonal antibody raised against a full-length human MAPRE1 protein.

The protein encoded by this gene was first identified by its binding to the APC protein which is often mutated in familial and sporadic forms of colorectal cancer. This protein localizes to microtubules, especially the growing ends, in interphase cells. During mitosis, the protein is associated with the centrosomes and spindle microtubules. The protein also associates with components of the dynactin complex and the intermediate chain of cytoplasmic dynein. Because of these associations, it is thought that this protein is involved in the regulation of microtubule structures and chromosome stability. This gene is a member of the RP/EB family. [provided by RefSeq

Sequence: MAVNVYSTSVTSDNLSRHDMLAWINESLQLNLTKIEQLCSGAAYCQFMDMLFPGSIALKKVKFQAKLEHEYIQNFKILQAGFKRMGVDKIIPVDKLVKGKFQDNFEFVQWFKKFFDANYDGKDYDPVAARQGQETAVAPSLVAPALNKPKKPLTSSSAAPQRPISTQRTAAAPKAGPGVVRKNPGVGNGDDEAAELMQQVNVLKLTVEDLEKERDFYFGKLRNIELICQENEGENDPVLQRIVDILYATDEGFVIPDEGGPQEEQEEY

Specifications

• Antigen: microtubule-associated protein, RP/EB family, member 1
• Applications: Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a full-length human MAPRE1 protein.
• Formulation: No additive
• Gene: MAPRE1
• Gene Accession No.: NM_012325
• Gene Alias: EB1/MGC117374/MGC129946
• Gene Symbols: MAPRE1
• Host Species: Mouse
• Immunogen: MAPRE1 (NP_036457, 1 a.a. ∼ 268 a.a) full-length human protein.
• Quantity: 50 μL
• Regulatory Status: RUO
• Research Discipline: Cell Cycle
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 22919
• Target Species: Human, Mouse, Rat
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum