microtubule-associated protein, RP/EB family, member 2 (B02), Mouse anti-Human, Rat, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human MAPRE2 protein.

Supplier:  Abnova Corporation H00010982B02

Catalog No. 89-007-099

Description

The protein encoded by this gene shares significant homology to the adenomatous polyposis coli (APC) protein-binding EB1 gene family. The function of this protein is unknown; however, its homology suggests involvement in tumorigenesis of colorectal cancers and proliferative control of normal cells. This gene may belong to the intermediate/early gene family, involved in the signal transduction cascade downstream of the TCR. Alternative splicing results in multiple transcript variants. [provided by RefSeq

Sequence: MPGPTQTLSPNGENNNDIIQDNNGTIIPFRKHTVRGERSYSWGMAVNVYSTSITQETMSRHDIIAWVNDIVSLNYTKVEQLCSGAAYCQFMDMLFPGCISLKKVKFQAKLEHEYIHNFKLLQASFKRMNVDKVIPVEKLVKGRFQDNLDFIQWFKKFYDANYDGKEYDPVEARQGQDAIPPPDPGEQIFNLPKKSHHANSPTAGAAKSSPAAKPGSTPSRPSSAKRASSSGSASKSDKDLETQVIQLNEQVHSLKLALEGVEKERDFYFGKLREIELLCQEHGQENDDLVQRLMDILYASEEHEGHTEEPEAEEQAHEQQPPQQEEY

Specifications

• Antigen: microtubule-associated protein, RP/EB family, member 2
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a full-length human MAPRE2 protein.
• Gene: MAPRE2
• Gene Alias: EB1/EB2/RP1
• Host Species: Mouse
• Quantity: 50 μL
• Whole Molecule: Yes
• Gene ID (Entrez): 10982
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: No additive
• Gene Accession No.: NM_014268.1
• Gene Symbols: MAPRE2
• Immunogen: MAPRE2 (NP_055083.1, 1 a.a. ∼ 327 a.a) full-length human protein.
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Rat
• Form: Serum