Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89014147

methionyl-tRNA synthetase, Mouse, Clone: 5G5, Abnova™

Catalog No. 89014147 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-014-147 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-014-147 Supplier Abnova Corporation Supplier No. H00004141M01
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant MARS.

Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. The protein encoded by this gene belongs to the class I family of tRNA synthetases. [provided by RefSeq

Sequence: LFQKLENDQIESLRQRFGGGQAKTSPKPAVVETVTTAKPQQIQALMDEVTKQGNIVRELKAQKADKNEVAAEVAKLLDLKKQLAVAEGKPPEAPKGKKK

Specifications

Antigen methionyl-tRNA synthetase
Applications ELISA, Immunofluorescence, Western Blot
Classification Monoclonal
Clone 5G5
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant MARS.
Formulation PBS with no preservative; pH 7.4
Gene MARS
Gene Accession No. NM_004990
Gene Alias FLJ35667/METRS/MTRNS
Gene Symbols MARS
Host Species Mouse
Immunogen MARS (NP_004981, 801 a.a. ∼ 899 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 4141
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.