methyl-CpG binding domain protein 3, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-642	50 μL

Catalog No. 89-004-642 Supplier Abnova Corporation Supplier No. H00053615A01

Description

Mouse polyclonal antibody raised against a partial recombinant MBD3.

DNA methylation is the major modification of eukaryotic genomes and plays an essential role in mammalian development. Human proteins MECP2, MBD1, MBD2, MBD3, and MBD4 comprise a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). However, unlike the other family members, MBD3 is not capable of binding to methylated DNA. The predicted MBD3 protein shares 71% and 94% identity with MBD2 (isoform 1) and mouse Mbd3. MBD3 is a subunit of the NuRD, a multisubunit complex containing nucleosome remodeling and histone deacetylase activities. MBD3 mediates the association of metastasis-associated protein 2 (MTA2) with the core histone deacetylase complex. [provided by RefSeq

Sequence: LMSKMNKSRQRVRYDSSNQVKGKPDLNTALPVRQTASIFKQPVTKITNHPSNKVKSDPQKAVDQPRQLFWEKKLSGLNAFDIAEELVKTMDLPKGLQGVGPGCTDETLLS

Specifications

• Antigen: methyl-CpG binding domain protein 3
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant MBD3.
• Formulation: 50% glycerol
• Gene: MBD3
• Gene Accession No.: NM_003926
• Gene Symbols: MBD3
• Host Species: Mouse
• Immunogen: MBD3 (NP_003917, 70 a.a. ∼ 179 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 53615
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum