methyl CpG binding protein 2 (Rett syndrome), Mouse, Clone: 4B6, Abnova™

Catalog No.	Quantity
89-014-149	100 μg

Catalog No. 89-014-149 Supplier Abnova Corporation Supplier No. H00004204M01

Description

Mouse monoclonal antibody raised against a partial recombinant MECP2.

DNA methylation is the major modification of eukaryotic genomes and plays an essential role in mammalian development. Human proteins MECP2, MBD1, MBD2, MBD3, and MBD4 comprise a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). Each of these proteins, with the exception of MBD3, is capable of binding specifically to methylated DNA. MECP2, MBD1 and MBD2 can also repress transcription from methylated gene promoters. In contrast to other MBD family members, MECP2 is X-linked and subject to X inactivation. MECP2 is dispensible in stem cells, but is essential for embryonic development. MECP2 gene mutations are the cause of most cases of Rett syndrome, a progressive neurologic developmental disorder and one of the most common causes of mental retardation in females. [provided by RefSeq

Sequence: PKQRRSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELIAYFEKVGDTSLDPNDFDFTVTGRGSPSRREQ

Specifications

• Antigen: methyl CpG binding protein 2 (Rett syndrome)
• Applications: ELISA, Immunohistochemistry (PFA fixed), Western Blot
• Classification: Monoclonal
• Clone: 4B6
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant MECP2.
• Formulation: PBS with no preservative; pH 7.4
• Gene: MECP2
• Gene Accession No.: BC011612
• Gene Alias: AUTSX3/DKFZp686A24160/MRX16/MRX79/MRXS13/MRXSL/PPMX/RTS/RTT
• Gene Symbols: MECP2
• Host Species: Mouse
• Immunogen: MECP2 (AAH11612, 81 a.a. ∼ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Transcription Regulation
• Primary or Secondary: Primary
• Gene ID (Entrez): 4204
• Target Species: Human, Mouse
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ