myocyte enhancer factor 2D, Mouse, Clone: 4D6, Abnova™

Mouse monoclonal antibody raised against a partial recombinant MEF2D.

Supplier:  Abnova Corporation H00004209M01

Catalog No. 89-000-801

Description

Sequence: THSTQLGAPSRKPDLRVITSQAGKGLMHHLTEDHLDLNNAQRLGVSQSTHSLTTPVVSVATPSLLSQGLPFSSMPTAYNTDYQLTSAELSSLPAFS

Specifications

• Antigen: myocyte enhancer factor 2D
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_005920
• Gene Symbols: MEF2D
• Immunogen: MEF2D (NP_005911.1, 256 a.a. ∼ 351 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Research Discipline: Transcription Regulation
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA, Western Blot
• Clone: 4D6
• Description: Mouse monoclonal antibody raised against a partial recombinant MEF2D.
• Gene: MEF2D
• Gene Alias: DKFZp686I1536
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 4209
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2a κ