multiple endocrine neoplasia I, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-202	50 μL

Catalog No. 89-004-202 Supplier Abnova Corporation Supplier No. H00004221A01

Description

Mouse polyclonal antibody raised against a partial recombinant MEN1.

This gene encodes menin, a putative tumor suppressor associated with a syndrome known as multiple endocrine neoplasia type 1. In vitro studies have shown menin is localized to the nucleus, possesses two functional nuclear localization signals, and inhibits transcriptional activation by JunD, however, the function of this protein is not known. Two messages have been detected on northern blots but the larger message has not been characterized. Alternative splicing results in multiple transcript variants. [provided by RefSeq

Sequence: DKGLGTGQGAVSGPPRKPPGTVAGTARGPEGGSTAQVPAPAASPPPEGPVLTFQSEKMKGMKELLVATKINSSAIKLQLTAQSQVQMKKQKVSTPSDYTLSFLKRQRKGL

Specifications

• Antigen: multiple endocrine neoplasia I
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant MEN1.
• Formulation: 50% glycerol
• Gene: MEN1
• Gene Accession No.: NM_000244
• Gene Alias: MEAI/SCG2
• Gene Symbols: MEN1
• Host Species: Mouse
• Immunogen: MEN1 (NP_000235, 506 a.a. ∼ 615 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 4221
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum