Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89000805

mesenchyme homeobox 1, Mouse, Clone: 3D6, Abnova™

Catalog No. 89000805 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-000-805 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-000-805 Supplier Abnova Corporation Supplier No. H00004222M19
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a full-length recombinant MEOX1.

This gene encodes a member of a subfamily of nonclustered, diverged, antennapedia-like homeobox-containing genes. The encoded protein may play a role in the molecular signaling network regulating somite development. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq

Sequence: TEQHPAFPQSPNWHFPVSDARRRPNSGPAGGSKEMGTSSLGLVDTTGGPGDDYGVLGSTANETEKKSSRRRKESSDNQENRGKPEGSSK*

Specifications

Antigen mesenchyme homeobox 1
Applications ELISA, Western Blot
Classification Monoclonal
Clone 3D6
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a full length recombinant MEOX1.
Formulation PBS with no preservative; pH 7.4
Gene MEOX1
Gene Accession No. NM_004527
Gene Alias MOX1
Gene Symbols MEOX1
Host Species Mouse
Immunogen MEOX1 (NP_004518, 82 a.a. ∼ 170 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Transcription Regulation
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 4222
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.