mesoderm posterior 2 homolog (mouse), Mouse, Clone: 1C8, Abnova™

Catalog No.	Quantity
89-001-397	100 μg

Catalog No. 89-001-397 Supplier Abnova Corporation Supplier No. H00145873M01

Description

Mouse monoclonal antibody raised against a partial recombinant MESP2.

This gene encodes a member of the bHLH family of transcription factors and plays a key role in defining the rostrocaudal patterning of somites via interactions with multiple Notch signaling pathways. This gene is expressed in the anterior presomitic mesoderm and is downregulated immediately after the formation of segmented somites. This gene also plays a role in the formation of epithelial somitic mesoderm and cardiac mesoderm. Mutations in the MESP2 gene cause autosomal recessive spondylocostal dystosis 2 (SCD02). [provided by RefSeq

Sequence: AQSPPPQSLLGHDHWIFAQGWGWAGHWDSTSPASSSDSSGSCPCDGARGLPQPQPPSCSSRAAEAAATTPRRARTGPAGGQRQSASEREKLRMRTLARALHELRRFLPPSLAPAGQSLTKIETL

Specifications

• Antigen: mesoderm posterior 2 homolog (mouse)
• Applications: ELISA, Immunofluorescence
• Classification: Monoclonal
• Clone: 1C8
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant MESP2.
• Formulation: PBS with no preservative; pH 7.4
• Gene: MESP2
• Gene Accession No.: XM_085261
• Gene Alias: SCDO2/bHLHc6
• Gene Symbols: MESP2
• Host Species: Mouse
• Immunogen: MESP2 (XP_085261, 2 a.a. ∼ 125 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Transcription Regulation
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 145873
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ