mitofusin 2, Mouse, Clone: 4H8, Abnova™

Catalog No.	Quantity
89-001-156	100 μg

Catalog No. 89-001-156 Supplier Abnova Corporation Supplier No. H00009927M03

Description

Mouse monoclonal antibody raised against a partial recombinant MFN2.

This gene encodes a mitochondrial membrane protein that participates in mitochondrial fusion and contributes to the maintenance and operation of the mitochondrial network. This protein is involved in the regulation of vascular smooth muscle cell proliferation, and it may play a role in the pathophysiology of obesity. Mutations in this gene cause Charcot-Marie-Tooth disease type 2A2, and hereditary motor and sensory neuropathy VI, which are both disorders of the peripheral nervous system. Defects in this gene have also been associated with early-onset stroke. Two transcript variants encoding the same protein have been identified. [provided by RefSeq

Sequence: FKRQFVEHASEKLQLVISYTGSNCSHQVQQELSGTFAHLCQQVDVTRENLEQEIAAMNKKIEVLDSLQSKAKLLRNKAGWLDSELNMFTHQYLQPSR

Specifications

• Antigen: mitofusin 2
• Applications: ELISA, Immunohistochemistry (PFA fixed), KnockDown, Western Blot
• Classification: Monoclonal
• Clone: 4H8
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant MFN2.
• Formulation: PBS with no preservative; pH 7.4
• Gene: MFN2
• Gene Accession No.: NM_014874
• Gene Alias: CMT2A/CMT2A2/CPRP1/HSG/KIAA0214/MARF
• Gene Symbols: MFN2
• Host Species: Mouse
• Immunogen: MFN2 (NP_055689, 661 a.a. ∼ 757 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 9927
• Target Species: Human, Rat
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ