MOB1, Mps One Binder kinase activator-like 2C (yeast), Mouse, Purified MaxPab™ Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human MOBKL2C protein.

Supplier:  Abnova Corporation H00148932B01P

Catalog No. 89-016-624

Description

The protein encoded by this gene is similar to the yeast Mob1 protein. Yeast Mob1 binds Mps1p, a protein kinase essential for spindle pole body duplication and mitotic checkpoint regulation. Alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq

Sequence: MALCLKQVFAKDKTFRPRKRFEPGTQRFELYKKAQASLKSGLDLRSVVRLPPGENIDDWIAVHVVDFFNRINLIYGTMAERCSETSCPVMAGGPRYEYRWQDERQYRRPAKLSAPRYMALLMDWIEGLINDEEVFPTRVGVPFPKNFQQVCTKILTRLFRVFVHVYIHHFDSILSMGAEAHVNTCYKHFYYFIREFSLVDQRELEPLREMTERICH

Specifications

• Antigen: MOB1, Mps One Binder kinase activator-like 2C (yeast)
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a full-length human MOBKL2C protein.
• Gene: MOBKL2C
• Gene Alias: MGC26743/MOB3C
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_201403.1
• Gene Symbols: MOBKL2C
• Immunogen: MOBKL2C (NP_958805.1, 1 a.a. ∼ 216 a.a) full-length human protein.
• Quantity: 50 μg
• Research Discipline: Kinases
• Gene ID (Entrez): 148932
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG