Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89001471

myelin-associated oligodendrocyte basic protein, Mouse, Clone: 1H3, Abnova™

Catalog No. 89001471 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
200 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-001-471 200 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-001-471 Supplier Abnova Corporation Supplier No. H00004336M01A
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a full-length recombinant MOBP.

Sequence: MSQKPAKEGPRLSKNQKYSEHFSIHCCPPFTFLNSKKEIVDRKYSICKSGCFYQKKEEDWICCACQKTRLKRKIRPTPKKK

Specifications

Antigen myelin-associated oligodendrocyte basic protein
Applications ELISA, Western Blot
Classification Monoclonal
Clone 1H3
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a full length recombinant MOBP.
Formulation ascites with no preservative
Gene MOBP
Gene Accession No. BC022471
Gene Alias MGC87379
Gene Symbols MOBP
Host Species Mouse
Immunogen MOBP (AAH22471, 1 a.a. ∼ 81 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity 200 μL
Regulatory Status RUO
Research Discipline Neurobiology
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 4336
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Ascites
Isotype IgM κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.