v-mos Moloney murine sarcoma viral oncogene homolog, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human MOS protein.

Supplier:  Abnova Corporation H00004342B01

Catalog No. 89-005-780

Description

MOS is a serine/threonine kinase that activates the MAP kinase cascade through direct phosphorylation of the MAP kinase activator MEK (MAP2K1; MIM 176872) (Prasad et al., 2008 [PubMed 18246541]).[supplied by OMIM

Sequence: MPSPLALRPYLRSEFSPSVDARPCSSPSELPAKLLLGATLPRAPRLPRRLAWCSIDWEQVCLLQRLGAGGFGSVYKATYRGVPVAIKQVNKCTKNRLASRRSFWAELNVARLRHDNIVRVVAASTRTPAGSNSLGTIIMEFGGNVTLHQVIYGAAGHPEGDAGEPHCRTGGQLSLGKCLKYSLDVVNGLLFLHSQSIVHLDLKPANILISEQDVCKISDFGCSEKLEDLLCFQTPSYPLGGTYTHRAPELLKGEGVTPKADIYSFAITLWQMTTKQAPYSGERQHILYAVVAYDLRPSLSAAVFEDSLPGQRLGDVIQRCWRPSAAQRPSARLLLVDLTSLKAELG

Specifications

• Antigen: v-mos Moloney murine sarcoma viral oncogene homolog
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a full-length human MOS protein.
• Gene: MOS
• Gene Alias: MGC119962/MGC119963/MSV
• Host Species: Mouse
• Quantity: 50 μL
• Research Discipline: Cell Cycle
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: No additive
• Gene Accession No.: NM_005372.1
• Gene Symbols: MOS
• Immunogen: MOS (NP_005363.1, 1 a.a. ∼ 346 a.a) full-length human protein.
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 4342
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.