N-methylpurine-DNA glycosylase, Mouse, Clone: 2C5, Abnova™

Mouse monoclonal antibody raised against a partial recombinant MPG.

Supplier:  Abnova Corporation H00004350M07

Catalog No. 89-000-810

Description

Sequence: MPARSGAQFCRRMGQKKQRPARAGQPHSSSDAAQAPAEQPHSSSDAAQAPCPRERCLGPPTTPGPYRSIYFSSPKGHLTRLGLEFFDQPA

Specifications

• Antigen: N-methylpurine-DNA glycosylase
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: BC014991
• Gene Symbols: MPG
• Immunogen: MPG (AAH14991, 1 a.a. ∼ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Whole Molecule: Yes
• Gene ID (Entrez): 4350
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2a κ

• Applications: ELISA, Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
• Clone: 2C5
• Description: Mouse monoclonal antibody raised against a partial recombinant MPG.
• Gene: MPG
• Gene Alias: AAG/APNG/CRA36.1/MDG/Mid1/PIG11/PIG16/anpg
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody