mitochondrial ribosomal protein S27, Rabbit, Purified MaxPab™ Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against a full-length human MRPS27 protein.

Supplier:  Abnova Corporation H00023107D01P

Catalog No. 89-018-091

Description

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that may be a functional partner of the death associated protein 3 (DAP3). [provided by RefSeq

Sequence: MPLIWKPGYLDRALQVMEKVAASPEDIKLCREALDVLGAVLKALTSADGASEEQSQNDEDNQGSEKLVEQLDIEETEQSKLPQYLERFKALHSKLQALGKIESEGLLSLTTQLVKEKLSTCEAEDIATYEQNLQQWHLDLVQLIQREQQQREQAKQEYQAQKAAKASA

Specifications

• Antigen: mitochondrial ribosomal protein S27
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against a full-length human MRPS27 protein.
• Gene: MRPS27
• Gene Alias: FLJ21764/FLJ23348/KIAA0264/MRP-S27/S27mt
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: BC030521
• Gene Symbols: MRPS27
• Immunogen: MRPS27 (AAH30521.1, 1 a.a. ∼ 168 a.a) full-length human protein.
• Quantity: 100 μg
• Research Discipline: Stem Cell Biology
• Gene ID (Entrez): 23107
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG