mitochondrial ribosomal protein S35, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human MRPS35 protein.

Supplier:  Abnova Corporation H00060488B01

Catalog No. 89-008-032

Description

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that has had confusing nomenclature in the literature. Pseudogenes corresponding to this gene are found on chromosomes 3p, 5q, and 10q. [provided by RefSeq

Sequence: MAKEGNLELLKIPNFLHLTPVAIKKHCEALKDFCTEWPAALDSDEKCEKHFPIEIDCTDYVSSGPSVRNPRARVVVLRVKLSSLNLDDHAKKKLIKLVGERYCKTTDVLTIKTDRCPLRRQNYDYAVYLLTVLYHESWNTEEWEKSKTEADMEEYIWENSSSERNILETLLQMKAAEKNMEINKEELLGTKEIEEYKKSVVSLKNEEENENSISQYKESVKRLLNVT

Specifications

• Antigen: mitochondrial ribosomal protein S35
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a full-length human MRPS35 protein.
• Gene: MRPS35
• Gene Alias: DKFZp762P093/HDCMD11P/MDS023/MGC104278/MRP-S28/MRPS28
• Host Species: Mouse
• Quantity: 50 μL
• Whole Molecule: Yes
• Gene ID (Entrez): 60488
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: No additive
• Gene Accession No.: BC015862
• Gene Symbols: MRPS35
• Immunogen: MRPS35 (AAH15862, 1 a.a. ∼ 227 a.a) full-length human protein.
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum