MS4A2, Mouse, Clone: 3B1, Abnova™

Catalog No.	Quantity
89-022-065	100 μg

Catalog No. 89-022-065 Supplier Abnova Corporation Supplier No. H00002206M02

Description

Mouse monoclonal antibody raised against a partial recombinant MS4A2.

The allergic response involves the binding of allergen to receptor-bound IgE followed by cell activation and the release of mediators responsible for the manifestations of allergy. The IgE-receptor, a tetramer composed of an alpha, beta, and 2 disulfide-linked gamma chains, is found on the surface of mast cells and basophils. This gene encodes the beta subunit of the high affinity IgE receptor which is a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. This family member is localized to 11q12, among a cluster of family members. Alternative splicing results in multiple transcript variants encoding different isoforms

Sequence: MDTESNRRANLALPQEPSSVPAFEVLEISPQEVSSGRLLKSASSPPLHTWLTVLKKEQE

Specifications

• Antigen: MS4A2
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 3B1
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant MS4A2.
• Formulation: PBS with no preservative; pH 7.4
• Gene: MS4A2
• Gene Accession No.: NM_000139
• Gene Alias: APY/ATOPY/FCER1B/FCERI/IGEL/IGER/IGHER/MS4A1
• Gene Symbols: MS4A2
• Host Species: Mouse
• Immunogen: MS4A2 (NP_000130, 1 a.a. ∼ 59 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 2206
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2a κ