Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

mutS homolog 2, colon cancer, nonpolyposis type 1 (E. coli) (A01), Mouse anti-Human, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant MSH2.

Manufacturer:  Abnova Corporation H00004436A01

Catalog No. 89-004-205


Add to cart

Description

Description

MSH2 was identified as a locus frequently mutated in hereditary nonpolyposis colon cancer (HNPCC). When cloned, it was discovered to be a human homolog of the E. coli mismatch repair gene mutS, consistent with the characteristic alterations in microsatellite sequences (RER+ phenotype) found in HNPCC. [provided by RefSeq

Sequence: NFPKHVIECAKQKALELEEFQYIGESQGYDIMEPAAKKCYLEREQGEKIIQEFLSKVKQMPFTEMSEENITIKLKQLKAEVIAKNNSFVNEIISRIKVTT
Specifications

Specifications

mutS homolog 2, colon cancer, nonpolyposis type 1 (E. coli)
Unconjugated
50% glycerol
BC021566
COCA1|FCC1|HNPCC|HNPCC1|LCFS2
Mouse
50 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
4436
ELISA, Western Blot
Mouse polyclonal antibody raised against a partial recombinant MSH2.
MSH2
Serum
MSH2
MSH2 (AAH21566, 835 a.a. ~ 934 a.a) partial recombinant protein with GST tag.
RUO
Y
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit