msh homeobox 1, Mouse, Clone: 1D2, Abnova™

Mouse monoclonal antibody raised against a full-length recombinant MSX1.

Supplier:  Abnova Corporation H00004487M05

Catalog No. 89-000-816

Description

This gene encodes a member of the muscle segment homeobox gene family. The encoded protein functions as a transcriptional repressor during embryogenesis through interactions with components of the core transcription complex and other homeoproteins. It may also have roles in limb-pattern formation, craniofacial development, particularly odontogenesis, and tumor growth inhibition. Mutations in this gene, which was once known as homeobox 7, have been associated with nonsyndromic cleft lip with or without cleft palate 5, Witkop syndrome, Wolf-Hirschom syndrome, and autosomoal dominant hypodontia. [provided by RefSeq

Sequence: NRRAKAKRLQEAELEKLKMAAKPMLPPAAFGLSFPLGGPAAVAAAAGASLYGASGPFQRAALPVAPVGLYTAHVGYSMYHLT

Specifications

• Antigen: msh homeobox 1
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_002448
• Gene Symbols: MSX1
• Immunogen: MSX1 (NP_002439, 216 a.a. ∼ 297 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Whole Molecule: Yes
• Gene ID (Entrez): 4487
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2a κ

• Applications: ELISA, Immunoprecipitation, Western Blot
• Clone: 1D2
• Description: Mouse monoclonal antibody raised against a full length recombinant MSX1.
• Gene: MSX1
• Gene Alias: HOX7/HYD1
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody