MSX1, Mouse, Clone: 2B12, Abnova™

Catalog No.	Quantity
89-123-231	100 μg

Catalog No. 89-123-231 Supplier Abnova Corporation Supplier No. H00004487M03

Description

Mouse monoclonal antibody raised against a full-length recombinant MSX1.

This gene encodes a member of the muscle segment homeobox gene family. The encoded protein functions as a transcriptional repressor during embryogenesis through interactions with components of the core transcription complex and other homeoproteins. It may also have roles in limb-pattern formation, craniofacial development, particularly odontogenesis, and tumor growth inhibition. Mutations in this gene, which was once known as homeobox 7, have been associated with nonsyndromic cleft lip with or without cleft palate 5, Witkop syndrome, Wolf-Hirschom syndrome, and autosomoal dominant hypodontia. [provided by RefSeq

Sequence: NRRAKAKRLQEAELEKLKMAAKPMLPPAAFGLSFPLGGPAAVAAAAGASLYGASGPFQRAALPVAPVGLYTAHVGYSMYHLT

Specifications

• Antigen: MSX1
• Applications: ELISA, Immunoprecipitation
• Classification: Monoclonal
• Clone: 2B12
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full length recombinant MSX1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: MSX1
• Gene Accession No.: NM_002448
• Gene Alias: HOX7/HYD1
• Gene Symbols: MSX1
• Host Species: Mouse
• Immunogen: MSX1 (NP_002439, 216 a.a. ∼ 297 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 4487
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2a κ