msh homeobox 2, Mouse, Clone: 1F6, Abnova™

Catalog No.	Quantity
89-000-817	100 μg

Catalog No. 89-000-817 Supplier Abnova Corporation Supplier No. H00004488M04

Description

Mouse monoclonal antibody raised against a partial recombinant MSX2.

This gene encodes a member of the muscle segment homeobox gene family. The encoded protein is a transcriptional repressor whose normal activity may establish a balance between survival and apoptosis of neural crest-derived cells required for proper craniofacial morphogenesis. The encoded protein may also have a role in promoting cell growth under certain conditions and may be an important target for the RAS signaling pathways. Mutations in this gene are associated with parietal foramina 1 and craniosynostosis type 2. [provided by RefSeq

Sequence: TASVKSENSEDGAAWMQEPGRYSPPPRHMSPTTCTLRKHKTNRKPRTPFTTSQLLALERKFRQKQYLSIAERAEFSSSLNLTETQVKIWFQNRRAKAKRL*

Specifications

• Antigen: msh homeobox 2
• Applications: ELISA, Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
• Classification: Monoclonal
• Clone: 1F6
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant MSX2.
• Formulation: PBS with no preservative; pH 7.4
• Gene: MSX2
• Gene Accession No.: NM_002449
• Gene Alias: CRS2/FPP/HOX8/MSH/PFM/PFM1
• Gene Symbols: MSX2
• Host Species: Mouse
• Immunogen: MSX2 (NP_002440, 101 a.a. ∼ 201 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Transcription Regulation
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 4488
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ