Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

msh homeobox 2, Mouse, Clone: 1F6, Abnova™

Catalog No. 89000817 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-000-817 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-000-817 Supplier Abnova Corporation Supplier No. H00004488M04
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant MSX2.

This gene encodes a member of the muscle segment homeobox gene family. The encoded protein is a transcriptional repressor whose normal activity may establish a balance between survival and apoptosis of neural crest-derived cells required for proper craniofacial morphogenesis. The encoded protein may also have a role in promoting cell growth under certain conditions and may be an important target for the RAS signaling pathways. Mutations in this gene are associated with parietal foramina 1 and craniosynostosis type 2. [provided by RefSeq

Sequence: TASVKSENSEDGAAWMQEPGRYSPPPRHMSPTTCTLRKHKTNRKPRTPFTTSQLLALERKFRQKQYLSIAERAEFSSSLNLTETQVKIWFQNRRAKAKRL*

Specifications

Antigen msh homeobox 2
Applications ELISA, Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
Classification Monoclonal
Clone 1F6
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant MSX2.
Formulation PBS with no preservative; pH 7.4
Gene MSX2
Gene Accession No. NM_002449
Gene Alias CRS2/FPP/HOX8/MSH/PFM/PFM1
Gene Symbols MSX2
Host Species Mouse
Immunogen MSX2 (NP_002440, 101 a.a. ∼ 201 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Transcription Regulation
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 4488
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.