metastasis associated 1, Mouse, Clone: 4D5, Abnova™

Catalog No.	Quantity
89-001-115	100 μg

Catalog No. 89-001-115 Supplier Abnova Corporation Supplier No. H00009112M01

Description

Mouse monoclonal antibody raised against a partial recombinant MTA1.

This gene encodes a protein that was identified in a screen for genes expressed in metastatic cells, specifically, mammary adenocarcinoma cell lines. Expression of this gene has been correlated with the metastatic potential of at least two types of carcinomas although it is also expressed in many normal tissues. The role it plays in metastasis is unclear. It was initially thought to be the 70kDa component of a nucleosome remodeling deacetylase complex, NuRD, but it is more likely that this component is a different but very similar protein. These two proteins are so closely related, though, that they share the same types of domains. These domains include two DNA binding domains, a dimerization domain, and a domain commonly found in proteins that methylate DNA. The profile and activity of this gene product suggest that it is involved in regulating transcription and that this may be accomplished by chromatin remodeling. [provided by RefSeq

Sequence: MPSRGLANHGQTRHMGPSRNLLLNGKSYPTKVRLIRGGSLPPVKRRRMNWIDAPDDVFYMATEETRKIRKLLSSSETKRAARRPYKPIALRQSQALPPRP

Specifications

• Antigen: metastasis associated 1
• Applications: ELISA, Immunohistochemistry (PFA fixed), Western Blot
• Classification: Monoclonal
• Clone: 4D5
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant MTA1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: MTA1
• Gene Accession No.: NM_004689
• Gene Symbols: MTA1
• Host Species: Mouse
• Immunogen: MTA1 (NP_004680, 601 a.a. ∼ 700 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Transcription Regulation
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 9112
• Target Species: Human, Mouse, Rat
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG3 κ