metastasis associated 1 family, member 3, Mouse, Clone: 3B3, Abnova™

Mouse monoclonal antibody raised against a partial recombinant MTA3.

Supplier:  Abnova Corporation H00057504M02

Catalog No. 89-001-326

Description

Sequence: LKMPTQSEEEKLSPSPTTEDPRVRSHVSRQAMQGMPVRNTGSPKSAVKTRQAFFLHTTYFTKFARQVCKNTLRLRQAARRPFVAINYAAIRAECKMLLNS

Specifications

• Antigen: metastasis associated 1 family, member 3
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_020744
• Gene Symbols: MTA3
• Immunogen: MTA3 (NP_065795, 416 a.a. ∼ 515 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Research Discipline: Transcription Regulation
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA, Immunofluorescence
• Clone: 3B3
• Description: Mouse monoclonal antibody raised against a partial recombinant MTA3.
• Gene: MTA3
• Gene Alias: KIAA1266
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 57504
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2b κ