metal-regulatory transcription factor 1, Mouse, Clone: 2C12, Abnova™

Catalog No.	Quantity
89-000-818	100 μg

Catalog No. 89-000-818 Supplier Abnova Corporation Supplier No. H00004520M04

Description

Mouse monoclonal antibody raised against a partial recombinant MTF1.

This gene encodes a transcription factor that induces expression of metallothioneins and other genes involved in metal homeostasis in response to heavy metals such as cadmium, zinc, copper, and silver. The protein is a nucleocytoplasmic shuttling protein that accumulates in the nucleus upon heavy metal exposure and binds to promoters containing a metal-responsive element (MRE). [provided by RefSeq

Sequence: GTVYDRTTVLIEQDPGTLEDEDDDGQCGEHLPFLVGGEEGFHLIDHEAMSQGYVQHIISPDQIHLTINPGSTPMPRNIEGATLTLQSECPETKRKEVKRY

Specifications

• Antigen: metal-regulatory transcription factor 1
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 2C12
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant MTF1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: MTF1
• Gene Accession No.: NM_005955
• Gene Alias: MGC23036/MTF-1/ZRF
• Gene Symbols: MTF1
• Host Species: Mouse
• Immunogen: MTF1 (NP_005946, 41 a.a. ∼ 140 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Transcription Regulation
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 4520
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ