Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1-like, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant MTHFD1L.

Manufacturer:  Abnova Corporation H00025902A01

Catalog No. 89-004-576


Add to cart

Description

Description

One-carbon substituted forms of tetrahydrofolate (THF) are involved in the de novo synthesis of purines and thymidylate and support cellular methylation reactions through the regeneration of methionine from homocysteine. MTHFD1L is an enzyme involved in THF synthesis in mitochondria (Christensen et al., 2005 [PubMed 15611115]).[supplied by OMIM

Sequence: VFKTDTRAEIDLVCELAKRAGAFDAVPCYHWSVGGKGSVDLARAVREAASKRSRFQFLYDVQVPIVDKIRTIAQAVYGAKDIELSPEAQAKIDRYTQQG
Specifications

Specifications

methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1-like
Unconjugated
50% glycerol
NM_015440
DKFZp586G1517|FLJ21145|FTHFSDC1|MTC1THFS|dJ292B18.2
Mouse
50 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
25902
ELISA, Western Blot
Mouse polyclonal antibody raised against a partial recombinant MTHFD1L.
MTHFD1L
Serum
MTHFD1L
MTHFD1L (NP_056255, 801 a.a. ~ 899 a.a) partial recombinant protein with GST tag.
RUO
Y
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit