Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1-like, Mouse, Polyclonal Antibody, Abnova™

Catalog No. 89004576 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
50 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-004-576 50 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-004-576 Supplier Abnova Corporation Supplier No. H00025902A01
Add to Cart
Add to Cart

Mouse polyclonal antibody raised against a partial recombinant MTHFD1L.

One-carbon substituted forms of tetrahydrofolate (THF) are involved in the de novo synthesis of purines and thymidylate and support cellular methylation reactions through the regeneration of methionine from homocysteine. MTHFD1L is an enzyme involved in THF synthesis in mitochondria (Christensen et al., 2005 [PubMed 15611115]).[supplied by OMIM

Sequence: VFKTDTRAEIDLVCELAKRAGAFDAVPCYHWSVGGKGSVDLARAVREAASKRSRFQFLYDVQVPIVDKIRTIAQAVYGAKDIELSPEAQAKIDRYTQQG

Specifications

Antigen methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1-like
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Mouse polyclonal antibody raised against a partial recombinant MTHFD1L.
Formulation 50% glycerol
Gene MTHFD1L
Gene Accession No. NM_015440
Gene Alias DKFZp586G1517/FLJ21145/FTHFSDC1/MTC1THFS/dJ292B18.2
Gene Symbols MTHFD1L
Host Species Mouse
Immunogen MTHFD1L (NP_056255, 801 a.a. ∼ 899 a.a) partial recombinant protein with GST tag.
Quantity 50 μL
Regulatory Status RUO
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 25902
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Serum
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.