Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

5,10-methenyltetrahydrofolate synthetase (5-formyltetrahydrofolate cyclo-ligase), Mouse, Clone: 2C12, Abnova™

Catalog No. 89015849 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-015-849 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-015-849 Supplier Abnova Corporation Supplier No. H00010588M01
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant MTHFS.

Sequence: LPKTSWNIPQPGEGDVREEALSTGGLDLIFMPGLGFDKHGNRLGRGKGYYDAYLKRCLQHQEVKPYTLALAFKEQICLQVPVNENDMKVDEVLYEDSSTA

Specifications

Antigen 5,10-methenyltetrahydrofolate synthetase (5-formyltetrahydrofolate cyclo-ligase)
Applications ELISA, Western Blot
Classification Monoclonal
Clone 2C12
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant MTHFS.
Formulation PBS with no preservative; pH 7.4
Gene MTHFS
Gene Accession No. NM_006441
Gene Alias FLJ30410/HsT19268
Gene Symbols MTHFS
Host Species Mouse
Immunogen MTHFS (NP_006432, 104 a.a. ∼ 203 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 10588
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.