5,10-methenyltetrahydrofolate synthetase (5-formyltetrahydrofolate cyclo-ligase), Mouse, Clone: 2C12, Abnova™

Mouse monoclonal antibody raised against a partial recombinant MTHFS.

Supplier:  Abnova Corporation H00010588M01

Catalog No. 89-015-849

Description

Sequence: LPKTSWNIPQPGEGDVREEALSTGGLDLIFMPGLGFDKHGNRLGRGKGYYDAYLKRCLQHQEVKPYTLALAFKEQICLQVPVNENDMKVDEVLYEDSSTA

Specifications

• Antigen: 5,10-methenyltetrahydrofolate synthetase (5-formyltetrahydrofolate cyclo-ligase)
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_006441
• Gene Symbols: MTHFS
• Immunogen: MTHFS (NP_006432, 104 a.a. ∼ 203 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA, Western Blot
• Clone: 2C12
• Description: Mouse monoclonal antibody raised against a partial recombinant MTHFS.
• Gene: MTHFS
• Gene Alias: FLJ30410/HsT19268
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 10588
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG1 κ