Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

myotubularin 1, Mouse, Clone: 1C10, Abnova™

Catalog No. 89014151 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-014-151 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-014-151 Supplier Abnova Corporation Supplier No. H00004534M01
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant MTM1.

This gene encodes a dual-specificity phosphatase that acts on both phosphotyrosine and phosphoserine. It is required for muscle cell differentiation and mutations in this gene have been identified as being responsible for X-linked myotubular myopathy. [provided by RefSeq

Sequence: MASASTSKYNSHSLENESIKRTSRDGVNRDLTEAVPRLPGETLITDKEVIYICPFNGPIKGRVYITNYRLYLRSLETDSSLILDVPLGVISRIEKMGGAT

Specifications

Antigen myotubularin 1
Applications ELISA, Immunohistochemistry (PFA fixed), KnockDown, Western Blot
Classification Monoclonal
Clone 1C10
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant MTM1.
Formulation PBS with no preservative; pH 7.4
Gene MTM1
Gene Accession No. BC030779
Gene Alias CNM/MTMX/XLMTM
Gene Symbols MTM1
Host Species Mouse
Immunogen MTM1 (AAH30779, 1 a.a. ∼ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 4534
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.