MTPN (B03P), Mouse anti-Human, Purified MaxPab™ Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-002-868	50 μg

Catalog No. 89-002-868 Supplier Abnova Corporation Supplier No. H00136319B03P

Description

Mouse polyclonal antibody raised against a full-length human MTPN protein.

The transcript produced from this gene is bi-cistronic and can encode both myotrophin and leucine zipper protein 6. The myotrophin protein is associated with cardiac hypertrophy, where it is involved in the conversion of NFkappa B p50-p65 heterodimers to p50-p50 and p65-p65 homodimers. This protein also has a potential function in cerebellar morphogenesis, and it may be involved in the differentiation of cerebellar neurons, particularly of granule cells. A cryptic ORF at the 3' end of this transcript uses a novel internal ribosome entry site and a non-AUG translation initiation codon to produce leucine zipper protein 6, a 6.4kDa tumor antigen that is associated with myeloproliferative disease. [provided by RefSeq]

Sequence: MCDKEFMWALKNGDLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTAFEATDNQAIKALLQ

Specifications

• Antigen: MTPN
• Applications: Immunofluorescence, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a full-length human MTPN protein.
• Formulation: PBS with no preservative; pH 7.4
• Gene: MTPN
• Gene Accession No.: NM_145808
• Gene Alias: FLJ31098/FLJ99857/GCDP/V-1
• Gene Symbols: MTPN
• Host Species: Mouse
• Immunogen: MTPN (NP_665807.1, 1 a.a. ∼ 118 a.a) full-length human protein.
• Purification Method: Affinity chromatography
• Quantity: 50 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 136319
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Purified
• Isotype: IgG