Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

MTPN, Mouse, Clone: 1F3, Abnova™

Catalog No. 89002659 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-002-659 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-002-659 Supplier Abnova Corporation Supplier No. H00136319M14
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a full-length recombinant MTPN.

The transcript produced from this gene is bi-cistronic and can encode both myotrophin and leucine zipper protein 6. The myotrophin protein is associated with cardiac hypertrophy, where it is involved in the conversion of NFkappa B p50-p65 heterodimers to p50-p50 and p65-p65 homodimers. This protein also has a potential function in cerebellar morphogenesis, and it may be involved in the differentiation of cerebellar neurons, particularly of granule cells. A cryptic ORF at the 3' end of this transcript uses a novel internal ribosome entry site and a non-AUG translation initiation codon to produce leucine zipper protein 6, a 6.4kDa tumor antigen that is associated with myeloproliferative disease. [provided by RefSeq]

Sequence: MCDKEFMWALKNGGLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTAFEATDNQAIKALLQ

Specifications

Antigen MTPN
Applications ELISA, Immunofluorescence, Western Blot
Classification Monoclonal
Clone 1F3
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a full-length recombinant MTPN.
Formulation PBS with no preservative; pH 7.4
Gene MTPN
Gene Accession No. BC028093
Gene Alias FLJ31098/FLJ99857/GCDP/V-1
Gene Symbols MTPN
Host Species Mouse
Immunogen MTPN (AAH28093, 1 a.a. ∼ 118 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 136319
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.