Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

MTPN, Mouse, Clone: 1F3, Abnova™

Mouse monoclonal antibody raised against a full-length recombinant MTPN.

Manufacturer:  Abnova Corporation H00136319M14

Catalog No. 89-002-659


Add to cart

Description

Description

The transcript produced from this gene is bi-cistronic and can encode both myotrophin and leucine zipper protein 6. The myotrophin protein is associated with cardiac hypertrophy, where it is involved in the conversion of NFkappa B p50-p65 heterodimers to p50-p50 and p65-p65 homodimers. This protein also has a potential function in cerebellar morphogenesis, and it may be involved in the differentiation of cerebellar neurons, particularly of granule cells. A cryptic ORF at the 3' end of this transcript uses a novel internal ribosome entry site and a non-AUG translation initiation codon to produce leucine zipper protein 6, a 6.4kDa tumor antigen that is associated with myeloproliferative disease. [provided by RefSeq

Sequence: MCDKEFMWALKNGGLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTAFEATDNQAIKALLQ
Specifications

Specifications

MTPN
1F3
Mouse monoclonal antibody raised against a full-length recombinant MTPN.
MTPN
Liquid
MTPN
MTPN (AAH28093, 1 a.a. ~ 118 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
100 ug
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Monoclonal
Human
ELISA, Immunofluorescence, Western Blot
Unconjugated
In 1X PBS, pH 7.4
BC028093
FLJ31098|FLJ99857|GCDP|V-1
Mouse
IgG2a Kappa
RUO
Primary
136319
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit