mucin 2, oligomeric mucus/gel-forming, Mouse, Clone: 1D10, Abnova™

Catalog No.	Quantity
89-000-820	100 μg

Catalog No. 89-000-820 Supplier Abnova Corporation Supplier No. H00004583M02

Description

Mouse monoclonal antibody raised against a partial recombinant MUC2.

This gene encodes a member of the mucin protein family. Mucins are high molecular weight glycoproteins produced by many epithelial tissues. The protein encoded by this gene is secreted and forms an insoluble mucous barrier that protects the gut lumen. The protein polymerizes into a gel of which 80% is composed of oligosaccharide side chains by weight. The protein features a central domain containing tandem repeats rich in threonine and proline that varies between 50 and 115 copies in different individuals. Alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known. [provided by RefSeq

Sequence: TTEVSYAGCTKTVLMNHCSGSCGTFVMYSAKAQALDHSCSCCKEEKTSQREVVLSCPNGGSLTHTYTHIESCQCQDTVCGLPTGTSRRARRSPRHLGSG*

Specifications

• Antigen: mucin 2, oligomeric mucus/gel-forming
• Applications: ELISA
• Classification: Monoclonal
• Clone: 1D10
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant MUC2.
• Formulation: PBS with no preservative; pH 7.4
• Gene: MUC2
• Gene Accession No.: NM_002457
• Gene Alias: MLP/SMUC
• Gene Symbols: MUC2
• Host Species: Mouse
• Immunogen: MUC2 (NP_002448, 5081 a.a. ∼ 5179 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 4583
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ