Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MUDENG Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP233765
Description
MUDENG Polyclonal specifically detects MUDENG in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
MUDENG | |
Polyclonal | |
Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
Q9H0R1 | |
AP5M1 | |
This antibody was developed against a recombinant protein corresponding to amino acids: PLQDILVHPCVTSLDSAILTSSSIDAMDDSAFSGPYKFPFTPPLESFNLCFYTSQVPVPPILGFYQMKEEEVQLRITI | |
0.1 mL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
Adapter-Related Protein Complex 5 Mu Subunit, Adaptor-Related Protein Complex 5, Mu 1 Subunit, AP-5 Complex Subunit Mu, AP-5 Complex Subunit Mu-1, C14orf108, Chromosome 14 Open Reading Frame 108, MHD Domain-Containing Death-Inducing Protein, Mu-2 Related Death-Inducing, Mu-2 Related Death-Inducing Gene, MU-2/AP1M2 Domain Containing, Death-Inducing, Mu-2-Related Death-Inducing Protein, Mu5, MuD, Putative HIV-1 Infection-Related Protein | |
Rabbit | |
Affinity Purified | |
RUO | |
55745 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction