MuRF1/TRIM63 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Supplier:  Novus Biologicals NBP154939

Catalog No. NBP154939

Description

MuRF1/TRIM63 Polyclonal specifically detects MuRF1/TRIM63 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: MuRF1/TRIM63
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 6.3.2.-, IRFMURF2, Iris RING finger protein, MuRF1, MuRF-1, muscle specific ring finger protein 2, Muscle-specific RING finger protein 1, RING finger protein 28FLJ32380, RNF28E3 ubiquitin-protein ligase TRIM63, SMRZMURF-1, Striated muscle RING zinc finger protein, tripartite motif containing 63, tripartite motif-containing 63, Tripartite motif-containing protein 63
• Host Species: Rabbit
• Molecular Weight of Antigen: 40 kDa
• Quantity: 100 μL
• Research Discipline: Zinc Finger
• Gene ID (Entrez): 84676
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q969Q1
• Gene Symbols: TRIM63
• Immunogen: Synthetic peptides corresponding to TRIM63(tripartite motif-containing 63) The peptide sequence was selected from the middle region of TRIM63. Peptide sequence EQLDKSTKLVETAIQSLDEPGGATFLLTAKQLIKSIVEASKGCQLGKTEQ.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only