muscle, skeletal, receptor tyrosine kinase, Mouse, Clone: 2H6, Abnova™

Catalog No.	Quantity
89-000-821	100 μg

Catalog No. 89-000-821 Supplier Abnova Corporation Supplier No. H00004593M07

Description

Mouse monoclonal antibody raised against a partial recombinant MUSK.

Intercellular communication is often mediated by receptors on the surface of one cell that recognize and are activated by specific protein ligands released by other cells. Members of one class of cell surface receptors, receptor tyrosine kinases (RTKs), are characterized by having a cytoplasmic domain containing intrinsic tyrosine kinase activity. This kinase activity is regulated by the binding of a cognate ligand to the extracellular portion of the receptor. DeChiara et al. (1996) [PubMed 8653786] noted that the RTKs, known to be expressed in cell type-specific fashions, play a role critical for the growth and differentiation of those cell types. For example, members of the neural-specific TRK family that recognize nerve growth factor are absolutely required for the survival and development of discrete neuronal subpopulations, and the receptor tyrosine kinases TIE1 (MIM 600222) and TIE2 (MIM 600221) play a critical role in the development of normal blood vessels.[supplied by OMIM

Sequence: ISIAEWSKPQKDNKGYCAQYRGEVCNAVLAKDALVFLNTSYADPEEAQELLVHTAWNELKVVSPVCRPAAEALLCNHIFQECSPGVVPTPIPICREYCLA

Specifications

• Antigen: muscle, skeletal, receptor tyrosine kinase
• Applications: ELISA, Immunohistochemistry (PFA fixed), Western Blot
• Classification: Monoclonal
• Clone: 2H6
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant MUSK.
• Formulation: PBS with no preservative; pH 7.4
• Gene: MUSK
• Gene Accession No.: NM_005592
• Gene Alias: MGC126323/MGC126324
• Gene Symbols: MUSK
• Host Species: Mouse
• Immunogen: MUSK (NP_005583, 301 a.a. ∼ 400 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Kinases
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 4593
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2b κ