v-myb myeloblastosis viral oncogene homolog (avian)-like 2, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-209	50 μL

Catalog No. 89-004-209 Supplier Abnova Corporation Supplier No. H00004605A01

Description

Mouse polyclonal antibody raised against a partial recombinant MYBL2.

The protein encoded by this gene, a member of the MYB family of transcription factor genes, is a nuclear protein involved in cell cycle progression. The encoded protein is phosphorylated by cyclin A/cyclin-dependent kinase 2 during the S-phase of the cell cycle and possesses both activator and repressor activities. It has been shown to activate the cell division cycle 2, cyclin D1, and insulin-like growth factor-binding protein 5 genes. Transcript variants may exist for this gene, but their full-length natures have not been determined. [provided by RefSeq

Sequence: TLPKSLSLPTTAPSNSSSLTLSGIKEDNSLLNQGFLQAKPEKAAVAQKPRSHFTTPAPMSSAWKTVACGGTRDQLFMQEKARQLLGRLKPSHTSRTLILS

Specifications

• Antigen: v-myb myeloblastosis viral oncogene homolog (avian)-like 2
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant MYBL2.
• Formulation: 50% glycerol
• Gene: MYBL2
• Gene Accession No.: BC053555
• Gene Alias: B-MYB/BMYB/MGC15600
• Gene Symbols: MYBL2
• Host Species: Mouse
• Immunogen: MYBL2 (AAH53555, 601 a.a. ∼ 700 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Research Discipline: Apoptosis
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 4605
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum