myosin, light chain 5, regulatory, Mouse, Clone: 3D12, Abnova™

Catalog No.	Quantity
89-000-824	100 μg

Catalog No. 89-000-824 Supplier Abnova Corporation Supplier No. H00004636M03

Description

Mouse monoclonal antibody raised against a partial recombinant MYL5.

This gene encodes one of the myosin light chains, a component of the hexameric ATPase cellular motor protein myosin. Myosin is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene product, one of the regulatory light chains, is expressed in fetal muscle and in adult retina, cerebellum, and basal ganglia. [provided by RefSeq

Sequence: RKTKKKEGGALRAQRASSNVFSNFEQTQIQEFKEAFTLMDQNRDGFIDKEDLKDTYASLGKTNVKDDELDAMLKEASGPINFTMFLNLFGEKL

Specifications

• Antigen: myosin, light chain 5, regulatory
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 3D12
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant MYL5.
• Formulation: PBS with no preservative; pH 7.4
• Gene: MYL5
• Gene Accession No.: NM_002477
• Gene Symbols: MYL5
• Host Species: Mouse
• Immunogen: MYL5 (NP_002468, 4 a.a. ∼ 96 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 4636
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG1 κ