myosin, light chain 9, regulatory, Mouse, Clone: 3F2, Abnova™

Catalog No.	Quantity
89-001-177	100 μg

Catalog No. 89-001-177 Supplier Abnova Corporation Supplier No. H00010398M02

Description

Mouse monoclonal antibody raised against a full-length recombinant MYL9.

Myosin, a structural component of muscle, consists of two heavy chains and four light chains. The protein encoded by this gene is a myosin light chain that may regulate muscle contraction by modulating the ATPase activity of myosin heads. The encoded protein binds calcium and is activated by myosin light chain kinase. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: MSSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGFIHEDHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEFTRILKHGAKDKDD

Specifications

• Antigen: myosin, light chain 9, regulatory
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 3F2
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full length recombinant MYL9.
• Formulation: PBS with no preservative; pH 7.4
• Gene: MYL9
• Gene Accession No.: BC002648
• Gene Alias: LC20/MGC3505/MLC2/MRLC1/MYRL2
• Gene Symbols: MYL9
• Host Species: Mouse
• Immunogen: MYL9 (AAH02648.1, 1 a.a. ∼ 118 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 10398
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2b κ