N-6 adenine-specific DNA methyltransferase 1 (putative), Rabbit, Purified MaxPab™ Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against a full-length human N6AMT1 protein.

Supplier:  Abnova Corporation H00029104D01P

Catalog No. 89-018-148

Description

The protein encoded by this gene belongs to the methyltransferase superfamily. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified. [provided by RefSeq

Sequence: MAGENFATPFHGHVGRGAFSDVYEPAEDTFLLLDALEAAAAELAGVEICLEVGSGSGVVSAFLASMIGPQALYMCTDINPEAAACTLETARCNKVHIQPVITDLVGSHGIEAAWAGGRNGREVMDRFFPLVPDLLSPRGLFYLVTIKENNPEEILKIMKTKGLQGTTALSRQAGQETLSVLKFTKS

Specifications

• Antigen: N-6 adenine-specific DNA methyltransferase 1 (putative)
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against a full-length human N6AMT1 protein.
• Gene: N6AMT1
• Gene Alias: C21orf127/HEMK2/MGC19995/MTQ2/N6AMT/PRED28
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 29104
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: BC011554.1
• Gene Symbols: N6AMT1
• Immunogen: N6AMT1 (AAH11554.1, 1 a.a. ∼ 186 a.a) full-length human protein.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody